Lineage for d5jn5a4 (5jn5 A:422-562)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192501Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2192707Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2192746Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2192747Protein automated matches [254722] (3 species)
    not a true protein
  7. 2272957Species Homo sapiens [TaxId:9606] [316258] (5 PDB entries)
  8. 2286192Domain d5jn5a4: 5jn5 A:422-562 [329493]
    Other proteins in same PDB: d5jn5a1, d5jn5a2, d5jn5a3, d5jn5a5, d5jn5b1, d5jn5b2, d5jn5b3
    automated match to d5f9ca4
    complexed with ca, so4

Details for d5jn5a4

PDB Entry: 5jn5 (more details), 1.75 Å

PDB Description: crystal structure of the d263y missense variant of human pgm1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5jn5a4:

Sequence, based on SEQRES records: (download)

>d5jn5a4 d.129.2.0 (A:422-562) automated matches {Homo sapiens [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Sequence, based on observed residues (ATOM records): (download)

>d5jn5a4 d.129.2.0 (A:422-562) automated matches {Homo sapiens [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsggatirlyidsyekdvakinqdpqvmlaplisialk
vsqlqertgrtaptvit

SCOPe Domain Coordinates for d5jn5a4:

Click to download the PDB-style file with coordinates for d5jn5a4.
(The format of our PDB-style files is described here.)

Timeline for d5jn5a4:

  • d5jn5a4 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09