Lineage for d1gsbc2 (1gsb C:1-84)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181240Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 181267Domain d1gsbc2: 1gsb C:1-84 [32949]
    Other proteins in same PDB: d1gsba1, d1gsbb1, d1gsbc1, d1gsbd1

Details for d1gsbc2

PDB Entry: 1gsb (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

SCOP Domain Sequences for d1gsbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsbc2 c.47.1.5 (C:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d1gsbc2:

Click to download the PDB-style file with coordinates for d1gsbc2.
(The format of our PDB-style files is described here.)

Timeline for d1gsbc2: