Lineage for d5m18a3 (5m18 A:328-668)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2218404Protein Penicillin binding protein 2a (PBP2A), C-terminal domain [82838] (1 species)
  7. 2218405Species Staphylococcus aureus [TaxId:1280] [82839] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2286187Domain d5m18a3: 5m18 A:328-668 [329488]
    Other proteins in same PDB: d5m18a1, d5m18a2, d5m18b1, d5m18b2
    automated match to d1vqqa3
    complexed with cd, mur

Details for d5m18a3

PDB Entry: 5m18 (more details), 1.98 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of cefepime ligand
PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m18a3:

Sequence, based on SEQRES records: (download)

>d5m18a3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

Sequence, based on observed residues (ATOM records): (download)

>d5m18a3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmketgrqigwfisydkdnpnmmm
ainvkdvqdkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d5m18a3:

Click to download the PDB-style file with coordinates for d5m18a3.
(The format of our PDB-style files is described here.)

Timeline for d5m18a3:

  • d5m18a3 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09