SCOPe 2.08: Domain d5m18a1: 5m18 A:27-138

Lineage for d5m18a1 (5m18 A:27-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
   some sequence similarity to KSI
   automatically mapped to Pfam PF05223

6. Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [82597] (10 PDB entries)
   Uniprot O54286 27-668

8. Domain d5m18a1: 5m18 A:27-138 [329486]
   Other proteins in same PDB: d5m18a2, d5m18a3, d5m18b2, d5m18b3
   automated match to d1vqqa1
   complexed with cd, mur

Details for d5m18a1

PDB Entry: 5m18, 1.98 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of cefepime ligand

PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m18a1:

Sequence; same for both SEQRES and ATOM records:

>d5m18a1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d5m18a1:

• d5m18a1 first appeared in SCOPe 2.06
  
• d5m18a1 appears in SCOPe 2.07