Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily) N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet |
Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) |
Family e.7.1.0: automated matches [191440] (1 protein) not a true family |
Protein automated matches [190647] (11 species) not a true protein |
Species Staphylococcus aureus [TaxId:282459] [226423] (4 PDB entries) |
Domain d5j16b1: 5j16 B:1-266 [329465] Other proteins in same PDB: d5j16b2 automated match to d3t0ja_ complexed with ca, ipd, po4 |
PDB Entry: 5j16 (more details), 2.4 Å
SCOPe Domain Sequences for d5j16b1:
Sequence, based on SEQRES records: (download)
>d5j16b1 e.7.1.0 (B:1-266) automated matches {Staphylococcus aureus [TaxId: 282459]} malygfaqgliqeagirikqlmeqnltietksnpndlvtnvdkatedfifdtiletypnh qvlgeeghghdidtskgtvwvvdpidgtlnfvhqqenfaisigiyidgkpyagfvydvma dvlyhakvgegayrgsqplkplndsnlrqsiiginpnwltkpilgeifkeivndsrsara ygsaaleivsvatgnleaymtprlqpwdfagglvilyevngqasnllgepltisgpnsil vgnrglhqeisndylephhdaliqlh
>d5j16b1 e.7.1.0 (B:1-266) automated matches {Staphylococcus aureus [TaxId: 282459]} malygfaqgliqeagirikqlmeqnlvtnvdkatedfifdtiletypnhqvlgeeghidt skgtvwvvdpidgtlnfvhqqenfaisigiyidgkpyagfvydvmadvlyhakvgegayr gsqplkplndsnlrqsiiginpnwltkpilgeifkeivndsrsaraygsaaleivsvatg nleaymtprlqpwdfagglvilyevngqasnllgepltisgpnsilvgnrglhqeisndy lephhdaliqlh
Timeline for d5j16b1: