Lineage for d5j16b1 (5j16 B:1-266)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2219721Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2219722Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2220030Family e.7.1.0: automated matches [191440] (1 protein)
    not a true family
  6. 2220031Protein automated matches [190647] (10 species)
    not a true protein
  7. 2220058Species Staphylococcus aureus [TaxId:282459] [226423] (4 PDB entries)
  8. 2286164Domain d5j16b1: 5j16 B:1-266 [329465]
    Other proteins in same PDB: d5j16b2
    automated match to d3t0ja_
    complexed with ca, ipd, po4

Details for d5j16b1

PDB Entry: 5j16 (more details), 2.4 Å

PDB Description: crystal structure of inositol monophosphate bound saimpase-ii
PDB Compounds: (B:) Inositol monophosphatase family protein

SCOPe Domain Sequences for d5j16b1:

Sequence, based on SEQRES records: (download)

>d5j16b1 e.7.1.0 (B:1-266) automated matches {Staphylococcus aureus [TaxId: 282459]}
malygfaqgliqeagirikqlmeqnltietksnpndlvtnvdkatedfifdtiletypnh
qvlgeeghghdidtskgtvwvvdpidgtlnfvhqqenfaisigiyidgkpyagfvydvma
dvlyhakvgegayrgsqplkplndsnlrqsiiginpnwltkpilgeifkeivndsrsara
ygsaaleivsvatgnleaymtprlqpwdfagglvilyevngqasnllgepltisgpnsil
vgnrglhqeisndylephhdaliqlh

Sequence, based on observed residues (ATOM records): (download)

>d5j16b1 e.7.1.0 (B:1-266) automated matches {Staphylococcus aureus [TaxId: 282459]}
malygfaqgliqeagirikqlmeqnlvtnvdkatedfifdtiletypnhqvlgeeghidt
skgtvwvvdpidgtlnfvhqqenfaisigiyidgkpyagfvydvmadvlyhakvgegayr
gsqplkplndsnlrqsiiginpnwltkpilgeifkeivndsrsaraygsaaleivsvatg
nleaymtprlqpwdfagglvilyevngqasnllgepltisgpnsilvgnrglhqeisndy
lephhdaliqlh

SCOPe Domain Coordinates for d5j16b1:

Click to download the PDB-style file with coordinates for d5j16b1.
(The format of our PDB-style files is described here.)

Timeline for d5j16b1:

  • d5j16b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-08