SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j16b1 (5j16 B:1-266)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2219721Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2219722Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2220030Family e.7.1.0: automated matches [191440] (1 protein)
    not a true family
  6. 2220031Protein automated matches [190647] (10 species)
    not a true protein
  7. 2220058Species Staphylococcus aureus [TaxId:282459] [226423] (4 PDB entries)
  8. 2286164Domain d5j16b1: 5j16 B:1-266 [329465]
    Other proteins in same PDB: d5j16b2
    automated match to d3t0ja_
    complexed with ca, ipd, po4

Details for d5j16b1

PDB Entry: 5j16 (more details), 2.4 Å

PDB Description: crystal structure of inositol monophosphate bound saimpase-ii
PDB Compounds: (B:) Inositol monophosphatase family protein

SCOPe Domain Sequences for d5j16b1:

Sequence, based on SEQRES records: (download)

>d5j16b1 e.7.1.0 (B:1-266) automated matches {Staphylococcus aureus [TaxId: 282459]}
malygfaqgliqeagirikqlmeqnltietksnpndlvtnvdkatedfifdtiletypnh
qvlgeeghghdidtskgtvwvvdpidgtlnfvhqqenfaisigiyidgkpyagfvydvma
dvlyhakvgegayrgsqplkplndsnlrqsiiginpnwltkpilgeifkeivndsrsara
ygsaaleivsvatgnleaymtprlqpwdfagglvilyevngqasnllgepltisgpnsil
vgnrglhqeisndylephhdaliqlh

Sequence, based on observed residues (ATOM records): (download)

>d5j16b1 e.7.1.0 (B:1-266) automated matches {Staphylococcus aureus [TaxId: 282459]}
malygfaqgliqeagirikqlmeqnlvtnvdkatedfifdtiletypnhqvlgeeghidt
skgtvwvvdpidgtlnfvhqqenfaisigiyidgkpyagfvydvmadvlyhakvgegayr
gsqplkplndsnlrqsiiginpnwltkpilgeifkeivndsrsaraygsaaleivsvatg
nleaymtprlqpwdfagglvilyevngqasnllgepltisgpnsilvgnrglhqeisndy
lephhdaliqlh

SCOPe Domain Coordinates for d5j16b1:

Click to download the PDB-style file with coordinates for d5j16b1.
(The format of our PDB-style files is described here.)

Timeline for d5j16b1:

  • d5j16b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-08