SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k6ra2 (5k6r A:281-459)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107283Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 protein domains)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2107284Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)
  7. 2107300Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142123] (10 PDB entries)
    Uniprot P17597 281-459
  8. 2286162Domain d5k6ra2: 5k6r A:281-459 [329463]
    Other proteins in same PDB: d5k6ra1, d5k6ra3
    automated match to d1ybha1
    complexed with 6r5, fad, k, mg, nhe, tzd

Details for d5k6ra2

PDB Entry: 5k6r (more details), 2.73 Å

PDB Description: crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl
PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d5k6ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k6ra2 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvastlmglgsypc
ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae
igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg

SCOPe Domain Coordinates for d5k6ra2:

Click to download the PDB-style file with coordinates for d5k6ra2.
(The format of our PDB-style files is described here.)

Timeline for d5k6ra2:

  • d5k6ra2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-08