Lineage for d3fygb2 (3fyg B:1-84)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24442Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 24466Domain d3fygb2: 3fyg B:1-84 [32946]
    Other proteins in same PDB: d3fyga1, d3fygb1

Details for d3fygb2

PDB Entry: 3fyg (more details), 2.2 Å

PDB Description: crystal structure of tetradeca-(3-fluorotyrosyl)-glutathione s-transferase

SCOP Domain Sequences for d3fygb2:

Sequence, based on SEQRES records: (download)

>d3fygb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgxwnvrglthpirlllextdssxeekrxamgdapdxdrsqwlnekfklgldfpnlp
xlidgsrkitqsnaimrxlarkhh

Sequence, based on observed residues (ATOM records): (download)

>d3fygb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgwnvrglthpirllletdsseekramgdapddrsqwlnekfklgldfpnlplidgs
rkitqsnaimrlarkhh

SCOP Domain Coordinates for d3fygb2:

Click to download the PDB-style file with coordinates for d3fygb2.
(The format of our PDB-style files is described here.)

Timeline for d3fygb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fygb1