Lineage for d5k2oa3 (5k2o A:460-667)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108535Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 protein domains)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2108536Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)
  7. 2108552Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (11 PDB entries)
    Uniprot P17597 460-667
  8. 2286153Domain d5k2oa3: 5k2o A:460-667 [329454]
    Other proteins in same PDB: d5k2oa1, d5k2oa2, d5k2oa4
    automated match to d1ybha3
    complexed with 6qk, cit, fad, mg, tp9

Details for d5k2oa3

PDB Entry: 5k2o (more details), 2.87 Å

PDB Description: crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac
PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d5k2oa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k2oa3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa
aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy
kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv
icphqehvlpmipsggtfndvitegdgr

SCOPe Domain Coordinates for d5k2oa3:

Click to download the PDB-style file with coordinates for d5k2oa3.
(The format of our PDB-style files is described here.)

Timeline for d5k2oa3:

  • d5k2oa3 appears in periodic updates to SCOPe 2.06 starting on 2017-02-08