SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k2oa1 (5k2o A:86-280)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108260Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 protein domains)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2108261Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)
  7. 2108277Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142204] (10 PDB entries)
    Uniprot P17597 86-280
  8. 2286151Domain d5k2oa1: 5k2o A:86-280 [329452]
    Other proteins in same PDB: d5k2oa2, d5k2oa3, d5k2oa4
    automated match to d1ybha2
    complexed with 6qk, cit, fad, mg, tp9

Details for d5k2oa1

PDB Entry: 5k2o (more details), 2.87 Å

PDB Description: crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac
PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d5k2oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k2oa1 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
nweqamrlpgymsrm

SCOPe Domain Coordinates for d5k2oa1:

Click to download the PDB-style file with coordinates for d5k2oa1.
(The format of our PDB-style files is described here.)

Timeline for d5k2oa1:

  • d5k2oa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-08