SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jn5b4 (5jn5 B:422-562)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192501Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2192707Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2192746Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2192747Protein automated matches [254722] (3 species)
    not a true protein
  7. 2272957Species Homo sapiens [TaxId:9606] [316258] (5 PDB entries)
  8. 2286149Domain d5jn5b4: 5jn5 B:422-562 [329450]
    Other proteins in same PDB: d5jn5a1, d5jn5a2, d5jn5a3, d5jn5a5, d5jn5b1, d5jn5b2, d5jn5b3
    automated match to d5f9ca4
    complexed with ca, so4

Details for d5jn5b4

PDB Entry: 5jn5 (more details), 1.75 Å

PDB Description: crystal structure of the d263y missense variant of human pgm1
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5jn5b4:

Sequence, based on SEQRES records: (download)

>d5jn5b4 d.129.2.0 (B:422-562) automated matches {Homo sapiens [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Sequence, based on observed residues (ATOM records): (download)

>d5jn5b4 d.129.2.0 (B:422-562) automated matches {Homo sapiens [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgatirlyidsyekdvakinqdpqvmlaplisialkv
sqlqertgrtaptvit

SCOPe Domain Coordinates for d5jn5b4:

Click to download the PDB-style file with coordinates for d5jn5b4.
(The format of our PDB-style files is described here.)

Timeline for d5jn5b4:

  • d5jn5b4 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09