SCOP 1.69: Domain d3fyga2: 3fyg A:1-84

Lineage for d3fyga2 (3fyg A:1-84)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)

8. Domain d3fyga2: 3fyg A:1-84 [32945]
   Other proteins in same PDB: d3fyga1, d3fygb1

Details for d3fyga2

PDB Entry: 3fyg, 2.2 Å

PDB Description: crystal structure of tetradeca-(3-fluorotyrosyl)-glutathione s- transferase

SCOP Domain Sequences for d3fyga2:

Sequence; same for both SEQRES and ATOM records:

>d3fyga2 c.47.1.5 (A:1-84) Class mu GST {Rat (Rattus norvegicus)}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Timeline for d3fyga2:

• d3fyga2 first appeared (with stable ids) in SCOP 1.55
  
• d3fyga2 appears in SCOP 1.67
  
• d3fyga2 appears in SCOP 1.71
  
• d3fyga2 appears in the current release, SCOPe 2.08