Lineage for d5jn5b2 (5jn5 B:192-304)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141779Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2141780Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2141872Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2141873Protein automated matches [254721] (3 species)
    not a true protein
  7. 2272953Species Homo sapiens [TaxId:9606] [316254] (5 PDB entries)
  8. 2286147Domain d5jn5b2: 5jn5 B:192-304 [329448]
    Other proteins in same PDB: d5jn5a4, d5jn5a5, d5jn5b4
    automated match to d5f9ca2
    complexed with ca, so4

Details for d5jn5b2

PDB Entry: 5jn5 (more details), 1.75 Å

PDB Description: crystal structure of the d263y missense variant of human pgm1
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5jn5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jn5b2 c.84.1.0 (B:192-304) automated matches {Homo sapiens [TaxId: 9606]}
veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpypnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOPe Domain Coordinates for d5jn5b2:

Click to download the PDB-style file with coordinates for d5jn5b2.
(The format of our PDB-style files is described here.)

Timeline for d5jn5b2:

  • d5jn5b2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-08