SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jn5b1 (5jn5 B:2-191)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141779Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2141780Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2141872Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2141873Protein automated matches [254721] (3 species)
    not a true protein
  7. 2272953Species Homo sapiens [TaxId:9606] [316254] (5 PDB entries)
  8. 2286146Domain d5jn5b1: 5jn5 B:2-191 [329447]
    Other proteins in same PDB: d5jn5a4, d5jn5a5, d5jn5b4
    automated match to d5hshb1
    complexed with ca, so4

Details for d5jn5b1

PDB Entry: 5jn5 (more details), 1.75 Å

PDB Description: crystal structure of the d263y missense variant of human pgm1
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5jn5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jn5b1 c.84.1.0 (B:2-191) automated matches {Homo sapiens [TaxId: 9606]}
vkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvgg
dgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
gpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenkf
kpftveivds

SCOPe Domain Coordinates for d5jn5b1:

Click to download the PDB-style file with coordinates for d5jn5b1.
(The format of our PDB-style files is described here.)

Timeline for d5jn5b1:

  • d5jn5b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-08