Lineage for d5idia_ (5idi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2286141Species Thermotoga neapolitana [TaxId:2337] [329442] (1 PDB entry)
  8. 2286142Domain d5idia_: 5idi A: [329443]
    automated match to d1oima_
    complexed with act; mutant

Details for d5idia_

PDB Entry: 5idi (more details), 1.9 Å

PDB Description: structure of beta glucosidase 1a from thermotoga neapolitana, mutant e349a
PDB Compounds: (A:) 1,4-beta-D-glucan glucohydrolase

SCOPe Domain Sequences for d5idia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idia_ c.1.8.4 (A:) automated matches {Thermotoga neapolitana [TaxId: 2337]}
mkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiiekigakayrfsiswprilpegtgkvnqkgldfynriidtlleknitpfitiyhw
dlpfslqlkggwanrdiadwfaeysrvlfenfgdrvkhwitlnelwvvaivghlygvhap
gmkdiyvafhtvhnllrahaksvkvfretvkdgkigivfnngyfepasereediraarfm
hqfnnyplflnpiyrgeypdlvlefareylprnyeddmeeikqeidfvglnyysghmvky
dpnsparvsfvernlpktamgweivpegiywilkgvkeeynpqevyitgngaafddvvse
ggkvhdqnridylrahieqvwraiqdgvplkgyfvwslldnfewaegyskrfgivyvdyn
tqkriikdsgywysnviknnglt

SCOPe Domain Coordinates for d5idia_:

Click to download the PDB-style file with coordinates for d5idia_.
(The format of our PDB-style files is described here.)

Timeline for d5idia_:

  • d5idia_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08