Lineage for d5b2xb_ (5b2x B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2286140Domain d5b2xb_: 5b2x B: [329441]
    automated match to d2x7ya_
    complexed with dms, hem, w0t; mutant

Details for d5b2xb_

PDB Entry: 5b2x (more details), 1.9 Å

PDB Description: crystal structure of p450bm3 mutant with n-perfluoroheptanoyl-l- tryptophan
PDB Compounds: (B:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5b2xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b2xb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptfpafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5b2xb_:

Click to download the PDB-style file with coordinates for d5b2xb_.
(The format of our PDB-style files is described here.)

Timeline for d5b2xb_:

  • d5b2xb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08