SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j90b_ (5j90 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007586Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2007587Protein automated matches [191037] (11 species)
    not a true protein
  7. 2286137Species Flavobacterium johnsoniae [TaxId:376686] [329438] (1 PDB entry)
  8. 2286138Domain d5j90b_: 5j90 B: [329439]
    automated match to d3gzsa_
    complexed with edo

Details for d5j90b_

PDB Entry: 5j90 (more details), 1.39 Å

PDB Description: structure of fjoh_4558, a chitin-binding susd homolog from flavobacterium johnsoniae
PDB Compounds: (B:) RagB/SusD domain protein

SCOPe Domain Sequences for d5j90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j90b_ a.118.8.0 (B:) automated matches {Flavobacterium johnsoniae [TaxId: 376686]}
nhikggfapmfnniqvltpewvyqlqqglnsdiwsgymatptgfesgvnnttyalldnwn
gfiwdygyknvmfnaydiankskgkydqfyalslilkvegmhrmtdtfgpiiyskfgsnd
atiaydsqeevytqmfaeldtavaeltkridageastfestdmtgykgkyeswvrfantl
rlrlamrivkvkpalakteaekavaqkfgvmlvnddsfkivspvytnpiatissswldir
msadmesimkgyqdpriasyfdtskqfpneykgvrtgiaisgksdhqdfsgigavvrske
iylmnaaeayflraegalrgwnmggtaqelyeagikasfdqrgvsgaagyiadntktaaa
yvdpnfpennsdpvnnvtvawdaaatnevklqkiitqkwiagfpegqeawsdyrrtgypk
lfpvlknysggaittefgvrrinfvqsekagnsggvatgvsklggpdnggtrvwwdvnap
nf

SCOPe Domain Coordinates for d5j90b_:

Click to download the PDB-style file with coordinates for d5j90b_.
(The format of our PDB-style files is described here.)

Timeline for d5j90b_:

  • d5j90b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08