Lineage for d5j90b_ (5j90 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007586Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2007587Protein automated matches [191037] (12 species)
    not a true protein
  7. 2286137Species Flavobacterium johnsoniae [TaxId:376686] [329438] (1 PDB entry)
  8. 2286138Domain d5j90b_: 5j90 B: [329439]
    automated match to d3gzsa_
    complexed with edo

Details for d5j90b_

PDB Entry: 5j90 (more details), 1.39 Å

PDB Description: structure of fjoh_4558, a chitin-binding susd homolog from flavobacterium johnsoniae
PDB Compounds: (B:) RagB/SusD domain protein

SCOPe Domain Sequences for d5j90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j90b_ a.118.8.0 (B:) automated matches {Flavobacterium johnsoniae [TaxId: 376686]}
nhikggfapmfnniqvltpewvyqlqqglnsdiwsgymatptgfesgvnnttyalldnwn
gfiwdygyknvmfnaydiankskgkydqfyalslilkvegmhrmtdtfgpiiyskfgsnd
atiaydsqeevytqmfaeldtavaeltkridageastfestdmtgykgkyeswvrfantl
rlrlamrivkvkpalakteaekavaqkfgvmlvnddsfkivspvytnpiatissswldir
msadmesimkgyqdpriasyfdtskqfpneykgvrtgiaisgksdhqdfsgigavvrske
iylmnaaeayflraegalrgwnmggtaqelyeagikasfdqrgvsgaagyiadntktaaa
yvdpnfpennsdpvnnvtvawdaaatnevklqkiitqkwiagfpegqeawsdyrrtgypk
lfpvlknysggaittefgvrrinfvqsekagnsggvatgvsklggpdnggtrvwwdvnap
nf

SCOPe Domain Coordinates for d5j90b_:

Click to download the PDB-style file with coordinates for d5j90b_.
(The format of our PDB-style files is described here.)

Timeline for d5j90b_:

  • d5j90b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08