SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i0ya_ (5i0y A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033719Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) (S)
    Pfam PF10634
  5. 2033737Family b.1.33.0: automated matches [310673] (1 protein)
    not a true family
  6. 2033738Protein automated matches [310872] (2 species)
    not a true protein
  7. 2286133Species Escherichia coli [TaxId:340197] [329434] (2 PDB entries)
  8. 2286136Domain d5i0ya_: 5i0y A: [329437]
    Other proteins in same PDB: d5i0yb2
    automated match to d3lznb_
    complexed with cu

Details for d5i0ya_

PDB Entry: 5i0y (more details), 1.4 Å

PDB Description: copper-bound e46q variant of uropathogenic escherichia coli strain f11 fetp
PDB Compounds: (A:) Periplasmic protein-probably involved in high-affinity Fe2+ transport

SCOPe Domain Sequences for d5i0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i0ya_ b.1.33.0 (A:) automated matches {Escherichia coli [TaxId: 340197]}
fkeypagepvtmnemelaavylqpidmeprgmglpaakadvhlqadihavegnkngfgag
ewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppska
gmhrhtdsetgvgrwwkpfdvsyefkyvgl

SCOPe Domain Coordinates for d5i0ya_:

Click to download the PDB-style file with coordinates for d5i0ya_.
(The format of our PDB-style files is described here.)

Timeline for d5i0ya_:

  • d5i0ya_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08