SCOPe 2.08: Domain d5i0xb1: 5i0x B:3-153

Lineage for d5i0xb1 (5i0x B:3-153)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.0: automated matches [310673] (1 protein)
   not a true family

6. Protein automated matches [310872] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:340197] [329434] (4 PDB entries)

8. Domain d5i0xb1: 5i0x B:3-153 [329435]
   Other proteins in same PDB: d5i0xa2, d5i0xb2
   automated match to d3lznb_
   complexed with cu

Details for d5i0xb1

PDB Entry: 5i0x, 1.5 Å

PDB Description: copper-bound m90i variant of uropathogenic escherichia coli strain f11 fetp

PDB Compounds: (B:) Periplasmic protein-probably involved in high-affinity Fe2+ transport

SCOPe Domain Sequences for d5i0xb1:

Sequence; same for both SEQRES and ATOM records:

>d5i0xb1 b.1.33.0 (B:3-153) automated matches {Escherichia coli [TaxId: 340197]}
fkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfgag
ewipyltisytlvnndtgekqegtfmpivasdgphyganikmmgvgnykvtyhieppska
gmhrhtdsetgvgrwwkpfdvsyefkyvgln

Timeline for d5i0xb1:

• d5i0xb1 first appeared in SCOPe 2.06
  
• d5i0xb1 appears in SCOPe 2.07