Lineage for d6gsya2 (6gsy A:1-84)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181240Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 181263Domain d6gsya2: 6gsy A:1-84 [32943]
    Other proteins in same PDB: d6gsya1, d6gsyb1

Details for d6gsya2

PDB Entry: 6gsy (more details), 2.2 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsya2 c.47.1.5 (A:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgfwnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d6gsya2:

Click to download the PDB-style file with coordinates for d6gsya2.
(The format of our PDB-style files is described here.)

Timeline for d6gsya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsya1