SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i0vb_ (5i0v B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033719Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) (S)
    Pfam PF10634
  5. 2033737Family b.1.33.0: automated matches [310673] (1 protein)
    not a true family
  6. 2033738Protein automated matches [310872] (2 species)
    not a true protein
  7. 2033739Species Campylobacter jejuni [TaxId:354242] [311313] (8 PDB entries)
  8. 2286128Domain d5i0vb_: 5i0v B: [329429]
    Other proteins in same PDB: d5i0va2
    automated match to d3lznb_
    complexed with cl, cu, fe

Details for d5i0vb_

PDB Entry: 5i0v (more details), 1.65 Å

PDB Description: iron and copper-bound p19 from campylobacter jejuni under oxidizing conditions
PDB Compounds: (B:) Protein P19

SCOPe Domain Sequences for d5i0vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i0vb_ b.1.33.0 (B:) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtp

SCOPe Domain Coordinates for d5i0vb_:

Click to download the PDB-style file with coordinates for d5i0vb_.
(The format of our PDB-style files is described here.)

Timeline for d5i0vb_:

  • d5i0vb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08