SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gyrn_ (5gyr N:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987554Family a.24.3.2: Cytochrome c'-like [47179] (3 protein domains)
    automatically mapped to Pfam PF01322
  6. 1987555Protein Cytochrome c' [47180] (9 species)
  7. 2286118Species Allochromatium vinosum [TaxId:572477] [329419] (1 PDB entry)
  8. 2286122Domain d5gyrn_: 5gyr N: [329423]
    automated match to d1bbha_
    complexed with hem

Details for d5gyrn_

PDB Entry: 5gyr (more details), 1.6 Å

PDB Description: tetrameric allochromatium vinosum cytochrome c'
PDB Compounds: (N:) cytochrome c'

SCOPe Domain Sequences for d5gyrn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gyrn_ a.24.3.2 (N:) Cytochrome c' {Allochromatium vinosum [TaxId: 572477]}
aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp
gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa
ckschekyrak

SCOPe Domain Coordinates for d5gyrn_:

Click to download the PDB-style file with coordinates for d5gyrn_.
(The format of our PDB-style files is described here.)

Timeline for d5gyrn_:

  • d5gyrn_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08