Lineage for d5gyrb_ (5gyr B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987554Family a.24.3.2: Cytochrome c'-like [47179] (3 protein domains)
    automatically mapped to Pfam PF01322
  6. 1987555Protein Cytochrome c' [47180] (9 species)
  7. 2286118Species Allochromatium vinosum [TaxId:572477] [329419] (1 PDB entry)
  8. 2286119Domain d5gyrb_: 5gyr B: [329420]
    automated match to d1bbha_
    complexed with hem

Details for d5gyrb_

PDB Entry: 5gyr (more details), 1.6 Å

PDB Description: tetrameric allochromatium vinosum cytochrome c'
PDB Compounds: (B:) cytochrome c'

SCOPe Domain Sequences for d5gyrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gyrb_ a.24.3.2 (B:) Cytochrome c' {Allochromatium vinosum [TaxId: 572477]}
aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp
gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa
ckschekyrak

SCOPe Domain Coordinates for d5gyrb_:

Click to download the PDB-style file with coordinates for d5gyrb_.
(The format of our PDB-style files is described here.)

Timeline for d5gyrb_:

  • d5gyrb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08