SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b2yb_ (5b2y B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2286109Domain d5b2yb_: 5b2y B: [329410]
    automated match to d2x7ya_
    complexed with hem, w10

Details for d5b2yb_

PDB Entry: 5b2y (more details), 2.01 Å

PDB Description: crystal structure of p450bm3 with n-perfluorodecanoyl-l-tryptophan
PDB Compounds: (B:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5b2yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b2yb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
empqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacd
esrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdia
vqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvralde
amnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdp
etgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
edhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5b2yb_:

Click to download the PDB-style file with coordinates for d5b2yb_.
(The format of our PDB-style files is described here.)

Timeline for d5b2yb_:

  • d5b2yb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08