SCOP 1.59: Domain d5fwga2: 5fwg A:1-84

Lineage for d5fwga2 (5fwg A:1-84)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)

8. Domain d5fwga2: 5fwg A:1-84 [32941]
   Other proteins in same PDB: d5fwga1, d5fwgb1

Details for d5fwga2

PDB Entry: 5fwg, 2 Å

PDB Description: tetra-(5-fluorotryptophanyl)-glutathione transferase

SCOP Domain Sequences for d5fwga2:

Sequence; same for both SEQRES and ATOM records:

>d5fwga2 c.47.1.5 (A:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgyxnvrglthpirllleytdssyeekryamgdapdydrsqxlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Timeline for d5fwga2:

• d5fwga2 first appeared (with stable ids) in SCOP 1.55
  
• d5fwga2 appears in SCOP 1.57
  
• d5fwga2 appears in SCOP 1.61
  
• d5fwga2 appears in the current release, SCOPe 2.08