SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b5ev_ (5b5e v:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981026Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981027Protein automated matches [190453] (22 species)
    not a true protein
  7. 2286104Species Thermosynechococcus vulcanus [TaxId:32053] [329405] (2 PDB entries)
  8. 2286106Domain d5b5ev_: 5b5e v: [329407]
    Other proteins in same PDB: d5b5ea_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5el_, d5b5ex_, d5b5ez_
    automated match to d1e29a_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5ev_

PDB Entry: 5b5e (more details), 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d5b5ev_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5ev_ a.3.1.0 (v:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5b5ev_:

Click to download the PDB-style file with coordinates for d5b5ev_.
(The format of our PDB-style files is described here.)

Timeline for d5b5ev_:

  • d5b5ev_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-03