Lineage for d5b5ev_ (5b5e v:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981026Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981027Protein automated matches [190453] (22 species)
    not a true protein
  7. 2286104Species Thermosynechococcus vulcanus [TaxId:32053] [329405] (6 PDB entries)
  8. 2286106Domain d5b5ev_: 5b5e v: [329407]
    Other proteins in same PDB: d5b5ea_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5el_, d5b5ex_, d5b5ez_
    automated match to d1e29a_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5ev_

PDB Entry: 5b5e (more details), 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d5b5ev_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5ev_ a.3.1.0 (v:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5b5ev_:

Click to download the PDB-style file with coordinates for d5b5ev_.
(The format of our PDB-style files is described here.)

Timeline for d5b5ev_:

  • d5b5ev_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-03