| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.5: PsbZ-like [161055] (2 families) ![]() automatically mapped to Pfam PF01737 |
| Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
| Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries) |
| Domain d5b66z_: 5b66 Z: [329399] Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_ automated match to d4pj0z_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b66 (more details), 1.85 Å
SCOPe Domain Sequences for d5b66z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b66z_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv
Timeline for d5b66z_: