Lineage for d5b66z_ (5b66 Z:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629660Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 2629661Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2629662Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2629673Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)
  8. 2629678Domain d5b66z_: 5b66 Z: [329399]
    Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_
    automated match to d4pj0z_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66z_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5b66z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66z_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d5b66z_:

Click to download the PDB-style file with coordinates for d5b66z_.
(The format of our PDB-style files is described here.)

Timeline for d5b66z_: