Lineage for d5b5ef_ (5b5e F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026798Protein automated matches [191000] (6 species)
    not a true protein
  7. 3026823Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries)
  8. 3026825Domain d5b5ef_: 5b5e F: [329398]
    Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5eu_, d5b5ev_, d5b5ex_, d5b5ez_
    automated match to d2axtf1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5ef_

PDB Entry: 5b5e (more details), 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5b5ef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5ef_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
vsypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5b5ef_:

Click to download the PDB-style file with coordinates for d5b5ef_.
(The format of our PDB-style files is described here.)

Timeline for d5b5ef_: