Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein automated matches [191000] (6 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries) |
Domain d5b5ef_: 5b5e F: [329398] Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5eu_, d5b5ev_, d5b5ex_, d5b5ez_ automated match to d2axtf1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b5e (more details), 1.87 Å
SCOPe Domain Sequences for d5b5ef_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b5ef_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} vsypiftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d5b5ef_: