Lineage for d5b66u_ (5b66 u:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999483Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1999718Family a.60.12.2: PsbU-like [158539] (2 protein domains)
    Pfam PF06514
  6. 1999729Protein automated matches [191005] (3 species)
    not a true protein
  7. 2286095Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (3 PDB entries)
  8. 2286096Domain d5b66u_: 5b66 u: [329397]
    Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66v_, d5b66z_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66u_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5b66u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66u_ a.60.12.2 (u:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5b66u_:

Click to download the PDB-style file with coordinates for d5b66u_.
(The format of our PDB-style files is described here.)

Timeline for d5b66u_:

  • d5b66u_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-03