Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein automated matches [191002] (3 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (9 PDB entries) |
Domain d5b66j_: 5b66 j: [329394] Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66h_, d5b66i_, d5b66k_, d5b66u_, d5b66v_, d5b66z_ automated match to d4ub8j_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b66 (more details), 1.85 Å
SCOPe Domain Sequences for d5b66j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b66j_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mmseggriplwivatvagmgvivivglffygayaglgssl
Timeline for d5b66j_: