SCOPe 2.06: Domain d5b66j_: 5b66 j:

Lineage for d5b66j_ (5b66 j:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family)
   automatically mapped to Pfam PF01788

5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
   Pfam PF01788

6. Protein automated matches [191002] (3 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (9 PDB entries)

8. Domain d5b66j_: 5b66 j: [329394]
   Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66h_, d5b66i_, d5b66k_, d5b66u_, d5b66v_, d5b66z_
   automated match to d4ub8j_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66j_

PDB Entry: 5b66, 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex

PDB Compounds: (j:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5b66j_:

Sequence; same for both SEQRES and ATOM records:

>d5b66j_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mmseggriplwivatvagmgvivivglffygayaglgssl

Timeline for d5b66j_:

• d5b66j_ is new in SCOPe 2.06-stable
  
• d5b66j_ appears in SCOPe 2.07
  
• d5b66j_ appears in the current release, SCOPe 2.08