Lineage for d5b66h_ (5b66 h:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631822Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 2631823Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2631824Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 2631834Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)
  8. 2631837Domain d5b66h_: 5b66 h: [329393]
    Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_
    automated match to d2axth1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66h_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (h:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5b66h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66h_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wk

SCOPe Domain Coordinates for d5b66h_:

Click to download the PDB-style file with coordinates for d5b66h_.
(The format of our PDB-style files is described here.)

Timeline for d5b66h_: