Lineage for d5b5eh_ (5b5e H:)
- Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) 
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) 
automatically mapped to Pfam PF00737Family f.23.33.1: PsbH-like [161026] (2 proteins)
Pfam PF00737
Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) 
Domain d5b5eh_: 5b5e H: [329388]
Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5ef_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5eu_, d5b5ev_, d5b5ex_, d5b5ez_
automated match to d2axth1
complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl
Details for d5b5eh_
PDB Entry: 5b5e (more details), 1.87 Å
PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (H:) Photosystem II reaction center protein HSCOPe Domain Sequences for d5b5eh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b5eh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka
SCOPe Domain Coordinates for d5b5eh_:
Click to download the PDB-style file with coordinates for d5b5eh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5b5eh_:
View in 3D
