Lineage for d5b5ex_ (5b5e X:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579439Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2579440Family f.23.40.1: PsbX-like [267615] (2 protein domains)
  6. 2579444Protein automated matches [267680] (2 species)
    not a true protein
  7. 2579454Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (12 PDB entries)
  8. 2579458Domain d5b5ex_: 5b5e X: [329386]
    Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5eu_, d5b5ev_, d5b5ez_
    automated match to d4il6x_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5ex_

PDB Entry: 5b5e (more details), 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d5b5ex_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5ex_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d5b5ex_:

Click to download the PDB-style file with coordinates for d5b5ex_.
(The format of our PDB-style files is described here.)

Timeline for d5b5ex_: