SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ug2a_ (5ug2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002485Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2002486Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2286077Domain d5ug2a_: 5ug2 A: [329378]
    automated match to d1kxna_
    complexed with 86j, hem

Details for d5ug2a_

PDB Entry: 5ug2 (more details), 1.34 Å

PDB Description: ccp gateless cavity
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d5ug2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ug2a_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d5ug2a_:

Click to download the PDB-style file with coordinates for d5ug2a_.
(The format of our PDB-style files is described here.)

Timeline for d5ug2a_:

  • d5ug2a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02