SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ue6b2 (5ue6 B:204-362)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037552Protein automated matches [226877] (4 species)
    not a true protein
  7. 2285996Species Neisseria gonorrhoeae [TaxId:242231] [329297] (2 PDB entries)
  8. 2286076Domain d5ue6b2: 5ue6 B:204-362 [329377]
    Other proteins in same PDB: d5ue6a1, d5ue6b1, d5ue6c1, d5ue6d1, d5ue6e1, d5ue6f1, d5ue6g1, d5ue6h1, d5ue6i1
    automated match to d1kbva2
    complexed with cu, na

Details for d5ue6b2

PDB Entry: 5ue6 (more details), 2.35 Å

PDB Description: structure of nitrite reductase ania from neisseria gonorrhoeae, space group i4122
PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d5ue6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue6b2 b.6.1.3 (B:204-362) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeimtqklsdta

SCOPe Domain Coordinates for d5ue6b2:

Click to download the PDB-style file with coordinates for d5ue6b2.
(The format of our PDB-style files is described here.)

Timeline for d5ue6b2:

  • d5ue6b2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02