Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (23 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries) |
Domain d5ue6b1: 5ue6 B:53-203 [329376] Other proteins in same PDB: d5ue6a2, d5ue6b2, d5ue6c2, d5ue6d2, d5ue6e2, d5ue6f2, d5ue6g2, d5ue6h2, d5ue6i2 automated match to d1kbva1 complexed with cu, na |
PDB Entry: 5ue6 (more details), 2.35 Å
SCOPe Domain Sequences for d5ue6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ue6b1 b.6.1.0 (B:53-203) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi yhcavapvgmhiangmyglilvepkeglpkv
Timeline for d5ue6b1: