Lineage for d5tqfl_ (5tqf L:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258104Protein Coagulation factor VIIa [57201] (1 species)
  7. 2258105Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2258165Domain d5tqfl_: 5tqf L: [329373]
    Other proteins in same PDB: d5tqfh_
    automated match to d1cvwl_
    complexed with 7kr, ca, gol, so4

Details for d5tqfl_

PDB Entry: 5tqf (more details), 1.85 Å

PDB Description: factor viia in complex with the inhibitor (11r)-11-[(1- aminoisoquinolin-6-yl)amino]-16-(cyclopropylsulfonyl)-13-methyl-2,13- diazatricyclo[13.3.1.1~6,10~]icosa-1(19),6(20),7,9,15,17-hexaene-3, 12-dione
PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d5tqfl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqfl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d5tqfl_:

Click to download the PDB-style file with coordinates for d5tqfl_.
(The format of our PDB-style files is described here.)

Timeline for d5tqfl_: