SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5swna_ (5swn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (80 species)
    not a true protein
  7. 2285917Species Rhodopseudomonas palustris [TaxId:258594] [329218] (7 PDB entries)
  8. 2286071Domain d5swna_: 5swn A: [329372]
    automated match to d3r40a_
    complexed with cl, fah

Details for d5swna_

PDB Entry: 5swn (more details), 1.54 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/fluoroacetate - cocrystallized
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5swna_:

Sequence, based on SEQRES records: (download)

>d5swna_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

Sequence, based on observed residues (ATOM records): (download)

>d5swna_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d5swna_:

Click to download the PDB-style file with coordinates for d5swna_.
(The format of our PDB-style files is described here.)

Timeline for d5swna_:

  • d5swna_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02