SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ujsb1 (5ujs B:1-418)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178854Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2178868Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2179069Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2179070Protein automated matches [190878] (13 species)
    not a true protein
  7. 2286044Species Campylobacter jejuni [TaxId:192222] [329345] (1 PDB entry)
  8. 2286067Domain d5ujsb1: 5ujs B:1-418 [329368]
    Other proteins in same PDB: d5ujsa2, d5ujsb2
    automated match to d3sg1a_
    complexed with cl

Details for d5ujsb1

PDB Entry: 5ujs (more details), 2.46 Å

PDB Description: 2.45 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from campylobacter jejuni.
PDB Compounds: (B:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d5ujsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujsb1 d.68.2.0 (B:1-418) automated matches {Campylobacter jejuni [TaxId: 192222]}
mtyleiegtnhlsgnvtisgaknaalplivssilaknevkinnvpnvadiktlisllenl
gakvnfqnnsallntntlnqtiakydivrkmrasiltlgpllarfghcevslpggcaigq
rpidlhllalekmganiqikqgyvvasgnlkgneilfdkitvtgseniimaaalakgktk
llnvakepevvqlcevlkdagleikgigtdeleiygsdgellefkefsvipdrieagtyl
cagaitnskitldkvnathlsavlaklhqmgfetlitedsitllpakeikpveimtseyp
gfptdmqaqfmalalkangtsiiderlfenrfmhvsellrmgadiklnghiativggkel
naadvmatdlrassalilaalaakgtskvhriyhldrgyenleekfkdlgakitrlee

SCOPe Domain Coordinates for d5ujsb1:

Click to download the PDB-style file with coordinates for d5ujsb1.
(The format of our PDB-style files is described here.)

Timeline for d5ujsb1:

  • d5ujsb1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5ujsb2