Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein automated matches [226877] (4 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:242231] [329297] (2 PDB entries) |
Domain d5ue6d2: 5ue6 D:204-362 [329364] Other proteins in same PDB: d5ue6a1, d5ue6b1, d5ue6c1, d5ue6d1, d5ue6e1, d5ue6f1, d5ue6g1, d5ue6h1, d5ue6i1 automated match to d1kbva2 complexed with cu, na |
PDB Entry: 5ue6 (more details), 2.35 Å
SCOPe Domain Sequences for d5ue6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ue6d2 b.6.1.3 (D:204-362) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakaget vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn ytlvdhsifrafnkgalgqlkvegaenpeimtqklsdta
Timeline for d5ue6d2: