SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tvrb_ (5tvr B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071116Family b.82.2.14: Histone demethylase core [254153] (4 protein domains)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 2071120Protein JMJD2A core [254342] (1 species)
  7. 2071121Species Human (Homo sapiens) [TaxId:9606] [254775] (39 PDB entries)
  8. 2286061Domain d5tvrb_: 5tvr B: [329362]
    automated match to d5f37b_
    complexed with akg, ni, zn

Details for d5tvrb_

PDB Entry: 5tvr (more details), 2.09 Å

PDB Description: jmjd2a in complex with ni(ii) and alpha-ketoglutarate
PDB Compounds: (B:) lysine-specific demethylase 4a

SCOPe Domain Sequences for d5tvrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tvrb_ b.82.2.14 (B:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]}
tlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlv
ipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknlt
fnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfa
whtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlis
plmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlc
scrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaae

SCOPe Domain Coordinates for d5tvrb_:

Click to download the PDB-style file with coordinates for d5tvrb_.
(The format of our PDB-style files is described here.)

Timeline for d5tvrb_:

  • d5tvrb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02