SCOPe Funding Alert: SCOPe support from the NIH
ended in April 2016. John-Marc Chandonia is the primary
maintainer and has continued to develop SCOPe using vacation
time. Three proposals to the NIH for continued funding have been
unsuccessful. If our current NIH proposal is not funded,
SCOPe will shut down permanently in Summer 2017
as Dr. Chandonia will need to seek a new position.
Lineage for d5ujfa1 (5ujf A:1-159)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the restSuperfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) 
Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains) 
Protein automated matches [190514] (11 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:83332] [329359] (1 PDB entry) 
Domain d5ujfa1: 5ujf A:1-159 [329360]
Other proteins in same PDB: d5ujfa2
automated match to d1df7a_
complexed with edo, mmv, so4
Details for d5ujfa1
PDB Entry: 5ujf (more details), 2.3 Å
PDB Description: crystal structure of mycobacterium tuberculosis dihydrofolate reductase bound p218 inhibitor
PDB Compounds: (A:) dihydrofolate reductaseSCOPe Domain Sequences for d5ujfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ujfa1 c.71.1.1 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs
SCOPe Domain Coordinates for d5ujfa1:
Click to download the PDB-style file with coordinates for d5ujfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ujfa1:
- d5ujfa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02
View in 3D
