SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ujfa1 (5ujf A:1-159)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2137177Protein automated matches [190514] (11 species)
    not a true protein
  7. 2286058Species Mycobacterium tuberculosis [TaxId:83332] [329359] (1 PDB entry)
  8. 2286059Domain d5ujfa1: 5ujf A:1-159 [329360]
    Other proteins in same PDB: d5ujfa2
    automated match to d1df7a_
    complexed with edo, mmv, so4

Details for d5ujfa1

PDB Entry: 5ujf (more details), 2.3 Å

PDB Description: crystal structure of mycobacterium tuberculosis dihydrofolate reductase bound p218 inhibitor
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5ujfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujfa1 c.71.1.1 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

SCOPe Domain Coordinates for d5ujfa1:

Click to download the PDB-style file with coordinates for d5ujfa1.
(The format of our PDB-style files is described here.)

Timeline for d5ujfa1:

  • d5ujfa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5ujfa2