SCOPe 2.07: Domain d5ujfa1: 5ujf A:1-159

Lineage for d5ujfa1 (5ujf A:1-159)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)

6. Protein automated matches [190514] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [329359] (1 PDB entry)

8. Domain d5ujfa1: 5ujf A:1-159 [329360]
   Other proteins in same PDB: d5ujfa2
   automated match to d1df7a_
   complexed with edo, mmv, so4

Details for d5ujfa1

PDB Entry: 5ujf, 2.3 Å

PDB Description: crystal structure of mycobacterium tuberculosis dihydrofolate reductase bound p218 inhibitor

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5ujfa1:

Sequence; same for both SEQRES and ATOM records:

>d5ujfa1 c.71.1.1 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d5ujfa1:

• d5ujfa1 first appeared in SCOPe 2.06