![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains) |
![]() | Protein automated matches [190514] (11 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [329359] (1 PDB entry) |
![]() | Domain d5ujfa1: 5ujf A:1-159 [329360] Other proteins in same PDB: d5ujfa2 automated match to d1df7a_ complexed with edo, mmv, so4 |
PDB Entry: 5ujf (more details), 2.3 Å
SCOPe Domain Sequences for d5ujfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ujfa1 c.71.1.1 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp reagdalapvldetwrgetgewrfsrsglryrlysyhrs
Timeline for d5ujfa1: