SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uidc_ (5uid C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (118 species)
    not a true protein
  7. 2286017Species Streptoalloteichus hindustanus [TaxId:2017] [329318] (1 PDB entry)
  8. 2286057Domain d5uidc_: 5uid C: [329358]
    automated match to d4piwb_
    complexed with plp, so4

Details for d5uidc_

PDB Entry: 5uid (more details), 2.18 Å

PDB Description: the crystal structure of an aminotransferase tlmj from streptoalloteichus hindustanus
PDB Compounds: (C:) Aminotransferase TlmJ

SCOPe Domain Sequences for d5uidc_:

Sequence, based on SEQRES records: (download)

>d5uidc_ c.67.1.0 (C:) automated matches {Streptoalloteichus hindustanus [TaxId: 2017]}
gminvfqptlgeaelaavrevfasgwlgrgprtkvfeadfaehlgvgaeqvvsvsccteg
lflsmellgvgpgdevvlpsisfvgaanaiaargarpvfcdvdpatlnptadhvaeklgp
rtkavvvlhyggypgdlvaiaelcrergvplvedsacavasqvdgracgtlgdvgvwsfd
amkilvtgdggmlcfrdpelaerarklaslgmaqssgfanatadaearwwefevtafgrr
sisndvaasigsvqlrrlpefvrrrreiaerydqglstvdglrcppplpaghtssyyfyw
vrmdasvrdamarrlydrgvyttfryaplhlvsayghegslpgaeraaeetlclplhqal
sdsdvetvigevraglaalt

Sequence, based on observed residues (ATOM records): (download)

>d5uidc_ c.67.1.0 (C:) automated matches {Streptoalloteichus hindustanus [TaxId: 2017]}
gminvfqptlgeaelaavrevfasgwlgrgprtkvfeadfaehlgvgaeqvvsvsccteg
lflsmellgvgpgdevvlpsisfvgaanaiaargarpvfcdvdpatlnptadhvaeklgp
rtkavvvlhyggypgdlvaiaelcrergvplvedsacavasqvdgracgtlgdvgvwsfd
amkilvtgdggmlcfrdpelaerarklaslgmaqrwwefevtafgrrsisndvaasigsv
qlrrlpefvrrrreiaerydqglstvdglrcppplpaghtssyyfywvrmdasvrdamar
rlydrgvyttfryaplhlvsayghegslpgaeraaeetlclplhqalsdsdvetvigevr
aglaalt

SCOPe Domain Coordinates for d5uidc_:

Click to download the PDB-style file with coordinates for d5uidc_.
(The format of our PDB-style files is described here.)

Timeline for d5uidc_:

  • d5uidc_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02