Lineage for d5ttga_ (5ttg A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073097Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2073098Protein automated matches [226914] (2 species)
    not a true protein
  7. 2073099Species Human (Homo sapiens) [TaxId:9606] [225158] (21 PDB entries)
  8. 2286056Domain d5ttga_: 5ttg A: [329357]
    automated match to d3mo5c_
    complexed with 7kz, cl, dms, gol, sam, unx, zn

Details for d5ttga_

PDB Entry: 5ttg (more details), 1.66 Å

PDB Description: crystal structure of catalytic domain of glp with ms012
PDB Compounds: (A:) Histone-lysine N-methyltransferase EHMT1

SCOPe Domain Sequences for d5ttga_:

Sequence, based on SEQRES records: (download)

>d5ttga_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkdgevy
cidarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdyger
fwdikgklfscrcgspkcrhs

Sequence, based on observed residues (ATOM records): (download)

>d5ttga_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldndgevyc
idarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerf
wdikgklfscrcgspkcrhs

SCOPe Domain Coordinates for d5ttga_:

Click to download the PDB-style file with coordinates for d5ttga_.
(The format of our PDB-style files is described here.)

Timeline for d5ttga_:

  • d5ttga_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02