SCOPe 2.08: Domain d5ue7b_: 5ue7 B:

Lineage for d5ue7b_ (5ue7 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [329348] (1 PDB entry)

8. Domain d5ue7b_: 5ue7 B: [329355]
   automated match to d2fuea_
   complexed with cl, mg

Details for d5ue7b_

PDB Entry: 5ue7, 1.95 Å

PDB Description: crystal structure of the phosphomannomutase pmm1 from candida albicans, apoenzyme state

PDB Compounds: (B:) Phosphomannomutase

SCOPe Domain Sequences for d5ue7b_:

Sequence; same for both SEQRES and ATOM records:

>d5ue7b_ c.108.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]}
sfankqdpktlvlfdvdgtltparltiseemkktleklrekvvigfvggsdlskqveqlg
pnvlndfdycfsengltayklgkelasqsfinwignekynklvkfilrylsdidlpirrg
tfiefrngminvspigrnastqerndyekfdkqhhiretmvealkkefpdfgltysiggq
isfdvfptgwdktyclqhvedehfenihffgdksykggndyeiyndprtighavnspddt
irilnetfklq

Timeline for d5ue7b_:

• d5ue7b_ first appeared in SCOPe 2.06
  
• d5ue7b_ appears in SCOPe 2.07