Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Candida albicans [TaxId:237561] [329348] (1 PDB entry) |
Domain d5ue7b_: 5ue7 B: [329355] automated match to d2fuea_ complexed with cl, mg |
PDB Entry: 5ue7 (more details), 1.95 Å
SCOPe Domain Sequences for d5ue7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ue7b_ c.108.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]} sfankqdpktlvlfdvdgtltparltiseemkktleklrekvvigfvggsdlskqveqlg pnvlndfdycfsengltayklgkelasqsfinwignekynklvkfilrylsdidlpirrg tfiefrngminvspigrnastqerndyekfdkqhhiretmvealkkefpdfgltysiggq isfdvfptgwdktyclqhvedehfenihffgdksykggndyeiyndprtighavnspddt irilnetfklq
Timeline for d5ue7b_: