Lineage for d6gsxa2 (6gsx A:1-84)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 245016Protein Class mu GST [81359] (3 species)
  7. 245050Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (14 PDB entries)
  8. 245061Domain d6gsxa2: 6gsx A:1-84 [32935]
    Other proteins in same PDB: d6gsxa1, d6gsxb1

Details for d6gsxa2

PDB Entry: 6gsx (more details), 2.1 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsxa2 c.47.1.5 (A:1-84) Class mu GST {Rat (Rattus norvegicus)}
pmilgfwnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d6gsxa2:

Click to download the PDB-style file with coordinates for d6gsxa2.
(The format of our PDB-style files is described here.)

Timeline for d6gsxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsxa1