Lineage for d5ue7a_ (5ue7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2286047Species Candida albicans [TaxId:237561] [329348] (1 PDB entry)
  8. 2286048Domain d5ue7a_: 5ue7 A: [329349]
    automated match to d2fuea_
    complexed with cl, mg

Details for d5ue7a_

PDB Entry: 5ue7 (more details), 1.95 Å

PDB Description: crystal structure of the phosphomannomutase pmm1 from candida albicans, apoenzyme state
PDB Compounds: (A:) Phosphomannomutase

SCOPe Domain Sequences for d5ue7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue7a_ c.108.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
sfankqdpktlvlfdvdgtltparltiseemkktleklrekvvigfvggsdlskqveqlg
pnvlndfdycfsengltayklgkelasqsfinwignekynklvkfilrylsdidlpirrg
tfiefrngminvspigrnastqerndyekfdkqhhiretmvealkkefpdfgltysiggq
isfdvfptgwdktyclqhvedehfenihffgdksykggndyeiyndprtighavnspddt
irilnetfklq

SCOPe Domain Coordinates for d5ue7a_:

Click to download the PDB-style file with coordinates for d5ue7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ue7a_:

  • d5ue7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02