SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ue7a_ (5ue7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2286047Species Candida albicans [TaxId:237561] [329348] (1 PDB entry)
  8. 2286048Domain d5ue7a_: 5ue7 A: [329349]
    automated match to d2fuea_
    complexed with cl, mg

Details for d5ue7a_

PDB Entry: 5ue7 (more details), 1.95 Å

PDB Description: crystal structure of the phosphomannomutase pmm1 from candida albicans, apoenzyme state
PDB Compounds: (A:) Phosphomannomutase

SCOPe Domain Sequences for d5ue7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue7a_ c.108.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
sfankqdpktlvlfdvdgtltparltiseemkktleklrekvvigfvggsdlskqveqlg
pnvlndfdycfsengltayklgkelasqsfinwignekynklvkfilrylsdidlpirrg
tfiefrngminvspigrnastqerndyekfdkqhhiretmvealkkefpdfgltysiggq
isfdvfptgwdktyclqhvedehfenihffgdksykggndyeiyndprtighavnspddt
irilnetfklq

SCOPe Domain Coordinates for d5ue7a_:

Click to download the PDB-style file with coordinates for d5ue7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ue7a_:

  • d5ue7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02