SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpuc_ (5tpu C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070601Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2070602Protein automated matches [190388] (21 species)
    not a true protein
  7. 2286005Species Campylobacter jejuni [TaxId:197] [329306] (1 PDB entry)
  8. 2286038Domain d5tpuc_: 5tpu C: [329339]
    Other proteins in same PDB: d5tpua2, d5tpud2
    automated match to d2pa7a1
    complexed with cl, tyd

Details for d5tpuc_

PDB Entry: 5tpu (more details), 2 Å

PDB Description: x-ray structure of the wlarb tdp-quinovose 3,4-ketoisomerase from campylobacter jejuni
PDB Compounds: (C:) Putative uncharacterized protein

SCOPe Domain Sequences for d5tpuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpuc_ b.82.1.0 (C:) automated matches {Campylobacter jejuni [TaxId: 197]}
iknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqvli
mmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaaay
irnydeflrni

SCOPe Domain Coordinates for d5tpuc_:

Click to download the PDB-style file with coordinates for d5tpuc_.
(The format of our PDB-style files is described here.)

Timeline for d5tpuc_:

  • d5tpuc_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02