Lineage for d5t4ta1 (5t4t A:1-300)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136616Species Rhodopseudomonas palustris [TaxId:1076] [267879] (9 PDB entries)
  8. 2286036Domain d5t4ta1: 5t4t A:1-300 [329337]
    Other proteins in same PDB: d5t4ta2
    automated match to d3r40a_
    complexed with act

Details for d5t4ta1

PDB Entry: 5t4t (more details), 1.51 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn - apo no halide
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5t4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4ta1 c.69.1.0 (A:1-300) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkv
ivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrla
ldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvka
klaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnki
pvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d5t4ta1:

Click to download the PDB-style file with coordinates for d5t4ta1.
(The format of our PDB-style files is described here.)

Timeline for d5t4ta1:

  • d5t4ta1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5t4ta2
View in 3D
Domains from other chains:
(mouse over for more information)
d5t4tb_