SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t4ta1 (5t4t A:1-300)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (82 species)
    not a true protein
  7. 2136616Species Rhodopseudomonas palustris [TaxId:1076] [267879] (9 PDB entries)
  8. 2286036Domain d5t4ta1: 5t4t A:1-300 [329337]
    Other proteins in same PDB: d5t4ta2
    automated match to d3r40a_
    complexed with act

Details for d5t4ta1

PDB Entry: 5t4t (more details), 1.51 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn - apo no halide
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5t4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4ta1 c.69.1.0 (A:1-300) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkv
ivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrla
ldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvka
klaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnki
pvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d5t4ta1:

Click to download the PDB-style file with coordinates for d5t4ta1.
(The format of our PDB-style files is described here.)

Timeline for d5t4ta1:

  • d5t4ta1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5t4ta2
View in 3D
Domains from other chains:
(mouse over for more information)
d5t4tb_