SCOPe 2.08: Domain d5ue6a2: 5ue6 A:204-362

Lineage for d5ue6a2 (5ue6 A:204-362)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein automated matches [226877] (4 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:242231] [329297] (2 PDB entries)

8. Domain d5ue6a2: 5ue6 A:204-362 [329336]
   Other proteins in same PDB: d5ue6a1, d5ue6b1, d5ue6c1, d5ue6d1, d5ue6e1, d5ue6f1, d5ue6g1, d5ue6h1, d5ue6i1
   automated match to d1kbva2
   complexed with cu, na

Details for d5ue6a2

PDB Entry: 5ue6, 2.35 Å

PDB Description: structure of nitrite reductase ania from neisseria gonorrhoeae, space group i4122

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d5ue6a2:

Sequence; same for both SEQRES and ATOM records:

>d5ue6a2 b.6.1.3 (A:204-362) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeimtqklsdta

Timeline for d5ue6a2:

• d5ue6a2 first appeared in SCOPe 2.06
  
• d5ue6a2 appears in SCOPe 2.07